Microbiology
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


Microbiology 150 (2004), 1495-1505; DOI  10.1099/mic.0.26877-0
This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via CrossRef
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Wyborn, N. R.
Right arrow Articles by Green, J.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Wyborn, N. R.
Right arrow Articles by Green, J.
Agricola
Right arrow Articles by Wyborn, N. R.
Right arrow Articles by Green, J.
Microbiology 150 (2004), 1495-1505; DOI  10.1099/mic.0.26877-0
© 2004 Society for General Microbiology

Properties of haemolysin E (HlyE) from a pathogenic Escherichia coli avian isolate and studies of HlyE export

Neil R. Wyborn1, Angela Clark1, Ruth E. Roberts1, Stuart J. Jamieson1, Svetomir Tzokov1, Per A. Bullough1, Timothy J. Stillman1, Peter J. Artymiuk1, James E. Galen2, Licheng Zhao2, Myron M. Levine2 and Jeffrey Green1

1 Krebs Institute for Biomolecular Research, Department of Molecular Biology and Biotechnology, University of Sheffield, Western Bank, Sheffield S10 2TN, UK
2 Center for Vaccine Development, Division of Infectious Diseases and Tropical Pediatrics, University of Maryland School of Medicine, 685 W. Baltimore St, Baltimore, MD 21201, USA

Correspondence
Jeffrey Green
jeff.green{at}sheffield.ac.uk


    ABSTRACT
 TOP
 ABSTRACT
 INTRODUCTION
 METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
Haemolysin E (HlyE) is a novel pore-forming toxin first identified in Escherichia coli K-12. Analysis of the 3-D structure of HlyE led to the proposal that a unique hydrophobic {beta}-hairpin structure (the {beta}-tongue, residues 177–203) interacts with the lipid bilayer in target membranes. In seeming contradiction to this, the hlyE sequence from a pathogenic E. coli strain (JM4660) that lacks all other haemolysins has been reported to encode an Arg residue at position 188 that was difficult to reconcile with the proposed role of the {beta}-tongue. Here it is shown that the JM4660 hlyE sequence encodes Gly, not Arg, at position 188 and that substitution of Gly188 by Arg in E. coli K-12 HlyE abolishes activity, emphasizing the importance of the head domain in HlyE function. Nevertheless, 76 other amino acid substitutions were confirmed compared to the HlyE protein of E. coli K-12. The JM4660 HlyE protein was dimeric, suggesting a mechanism for improving toxin solubility, and it lysed red blood cells from many species by forming 36–41 Å diameter pores. However, the haemolytic phenotype of JM4660 was found to be unstable due to defects in HlyE export, indicating that export of active HlyE is not an intrinsic property of the protein but requires additional components. TnphoA mutagenesis of hlyE shows that secretion from the cytoplasm to the periplasm does not require the carboxyl-terminal region of HlyE. Finally, disruption of genes associated with cell envelope function, including tatC, impairs HlyE export, indicating that outer membrane integrity is important for effective HlyE secretion.


Abbreviations: GSH, glutathione S-transferase


    INTRODUCTION
 TOP
 ABSTRACT
 INTRODUCTION
 METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
Recently a novel pore-forming toxin designated HlyE, ClyA or SheA has been identified in Escherichia coli and in Salmonella enterica serovars Typhi and Paratyphi A (del Castillo et al., 1997Down; Green & Baldwin, 1997Down; Oscarsson et al., 1996Down, 2002Down; Wallace et al., 2000Down). The HlyE protein is a 34 kDa rod-shaped molecule consisting of a bundle of four long (80–90 Å; 8–9 nm) helices, which coil around each other with significant elaborations at both poles of the four-helix bundle (Fig. 1Down) (Wallace et al., 2000Down). At the end that contains the N-terminal region an additional shorter (30 Å) helix ({alpha}G) packs against the four long helices, forming a five-helix bundle for about one-third of the length of the molecule (the tail domain). Mutagenesis has suggested that the {alpha}G region is involved in HlyE activity (Atkins et al., 2000Down; Oscarsson et al., 1999Down). The tail domain also houses the two Cys residues of HlyE, which can be linked by a disulphide bond (Atkins et al., 2000Down). At the opposite end of the molecule there is a subdomain (the head domain) consisting of a short two-stranded antiparallel {beta}-sheet flanked by two short helices (the {beta}-tongue), located between the third and fourth helices of the main bundle (Wallace et al., 2000Down). The hydrophobic nature of the {beta}-tongue has to be maintained to allow interaction between HlyE and target membranes (Oscarsson et al., 1999Down; Wallace et al., 2000Down). The HlyE protein forms pores in target membranes that appear in electron microscope images as ring-shaped structures with an internal diameter of 42–52 Å, when viewed from above, and as 100–105 Å spikes in side view, suggesting that HlyE does not undergo large conformational changes during pore formation (Wallace et al., 2000Down).



View larger version (32K):
[in this window]
[in a new window]
 
Fig. 1. The fold of the pore-forming toxin HlyE. The overall fold of an E. coli K-12 HlyE monomer is shown as a main chain ribbon with helices coloured cyan and strands coloured green. Non-identical residues between E. coli K-12 HlyE and avian E. coli HlyE are highlighted in dark blue and the positions of the conserved Cys residues (87 and 285) are shown in yellow. Secondary structural elements are labelled together with both termini and residue 188 (coloured red). Figure produced using MIDAS (Ferrin et al., 1988Down).

 
In E. coli K-12, hlyE expression is activated by the action of the global transcription factors FNR and CRP (cAMP receptor protein), in response to oxygen starvation and glucose starvation, respectively (Green & Baldwin, 1997Down; Westermark et al., 2000Down). Thus, expression of this gene responds to environmental conditions related to infection. E. coli is a major pathogen of birds, where infection usually begins with respiratory disease followed by septicaemia, granuloma, peritonitis, salpingitis, omphalitis and airsacculitis (Gross, 1991Down). Such pathological conditions lead to significant economic losses in the production of chickens and turkeys. Several protein toxins associated with E. coli pathogenesis have been identified, including haemolysins. The production of haemolysins by E. coli is associated with extra-intestinal infections in man, and thus haemolysins are considered to play an important role in pathogenesis. Indeed, the HlyE protein has been shown to be cytotoxic and apoptogenic to human and murine monocytes (Lai et al., 2000Down). The hlyE gene from a pathogenic E. coli avian strain, JM4660, that lacks the uropathogenic and enterohaemorrhagic haemolysin gene, hlyD, was isolated and sequenced (Reingold et al., 1999Down). According to this report, in comparison to E. coli K-12 the JM4660 hlyE gene encoded an amino acid substitution, Gly188->Arg (Reingold et al., 1999Down). Such a replacement was difficult to accommodate within the 3-D structure of HlyE without disrupting and rearranging the structure of the hydrophobic {beta}-tongue of HlyE (Fig. 1Up) (Wallace et al., 2000Down). In view of its probable role as the major pore-forming toxin of E. coli JM4660 the properties of this protein were investigated.


    METHODS
 TOP
 ABSTRACT
 INTRODUCTION
 METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
Bacterial strains, plasmids and oligonucleotides.
These are listed in Table 1Down.


View this table:
[in this window]
[in a new window]
 
Table 1. Bacterial strains, plasmids and oligonucleotides

For the oligonucleotides listed, unique restriction sites are italicized and mismatched bases directing desired codon changes are underlined. ApR: ampicillin resistance; KanR: kanamycin resistance.

 
PCR-based site-directed mutagenesis.
Site-directed mutagenesis was achieved by the overlap extension PCR technique (Sambrook & Russell, 2001Down) using appropriate mutagenic and flanking primers (Table 1Up). The authenticity of the altered hlyE genes was confirmed by automated DNA cycle sequencing before and after ligation into the expression vectors ptac85 (Marsh, 1986Down) and pGEX-KG (Guan & Dixon, 1991Down).

Characterization of HlyE proteins.
The HlyE proteins were isolated from GST–HlyE-overproducing strains as previously described (Atkins et al., 2000Down). The haemolysis assay of Rowe & Welch (1994)Down with horse blood was used for routine measurement of HlyE activity. Blood from other species was tested using the same protocol. All blood samples were obtained from TCS Microbiology (UK). Mass spectrometry (Micromass MALDI-TOF) measurements were made using samples of HlyE that had been dialysed against de-ionized water. Native molecular masses were estimated by gel filtration on a calibrated Superdex 200 HR 10/30 column (Amersham) equilibrated with 50 mM sodium phosphate pH 7·0, containing 150 mM NaCl. The SDS-PAGE analysis of purified proteins was as described previously (Atkins et al., 2000Down). The thermostability of the HlyE proteins was estimated by incubating equivalent amounts of protein (0·1 mg ml–1) for different periods at 37, 50 or 65 °C before incubating on ice for 30 min prior to determining the amount of HlyE activity remaining. The HlyE pores were visualized in lipid vesicles and the negatively stained images were obtained using the equipment and procedures previously described (Wallace et al., 2000Down).

Distribution of HlyE.
Subcellular fractionation was achieved by collecting the bacteria from aerobic cultures [200 ml Lennox broth (tryptone, 10 g l–1; yeast extract, 5 g l–1; NaCl, 5 g l–1) in 2 l conical flasks, grown for 16 h at 37 °C with shaking, 250 r.p.m.] of haemolytic and non-haemolytic variants of JM4660. The culture supernatants and bacterial pellets were retained. The supernatants were passed through 0·2 µm filters to remove any remaining bacteria before analysis, unless indicated. The bacterial cells were fractionated according to the protocol described by Sambrook & Russell (2001)Down. The bacterial pellets were suspended in 20 mM Tris/HCl, pH 8·0, containing 1·7 mM EDTA and 0·5 M sucrose (10 ml) and incubated for 1 h at room temperature with gentle shaking. The bacteria were then collected by centrifugation at 3500 g for 60 min at room temperature. The supernatants were discarded and the pellets resuspended in 10 mM Tris/HCl, pH 8·0 (4 ml). After incubation at room temperature with gentle shaking for 1 h the suspensions were centrifuged at 11 600 g for 30 min at 4 °C. The supernatant fraction contained periplasmic proteins (generally 0·8–1·0 mg protein ml–1). Cytoplasmic fractions were then obtained from the pellets by sonication. The cytoplasmic fractions contained 0·9–1·3 mg protein ml–1. The HlyE activities of the cytoplasmic and periplasmic fractions were expressed as the change in A543 min–1 mg–1, and for the external medium as the change in A543 min–1 ml–1 (Rowe & Welch, 1994Down). Aconitase and lipoamide dehydrogenase (E3 subunit of the pyruvate dehydrogenase complex) served as markers for the cytoplasmic fractions, and activities were assayed according to Gruer et al. (1997)Down and Creaghan & Guest (1972)Down, respectively. Aconitase activity was expressed as nmol cis-aconitate produced min–1 mg–1 and lipoamide dehydrogenase activity as nmol APAD (acetylpyridine dinucleotide) reduced h–1 mg–1.

Mutagenesis.
The transposon mutagenesis strategy used was based on the Epicentre EZ : : Tn<KAN-2>Tnp transposome kit (Cambio). The electrocompetent E. coli strain EC100 (>1x109 c.f.u. ml–1; supplied by Cambio) was simultaneously transformed with pGS415 (Table 1Up) and the transposome complex EZ : : Tn<KAN-2>Tnp (Table 1Up). After outgrowth for 1 h at 37 °C, transformants were plated on blood agar containing ampicillin (100 µg ml–1), kanamycin (30 µg ml–1) and IPTG (0·125 mM) to yield ~150–200 colonies per plate. After growth at 37 °C for 16–24 h, colonies displaying reduced haemolysis were selected and streaked onto fresh plates to confirm the phenotype. Genomic DNA was then prepared from each isolate using the Qiagen DNeasy protocol. Direct genomic DNA sequencing, using the primer FP-1 (ACCTACAACAAAGCTCTCATCAACC; Cambio), which is complementary to the EZ : : Tn<KAN-2>Tnp sequence, was used to locate the transposon insertion site within the genome. Specifically, template DNA was incubated at 55 °C for 30 min, to enhance solubility, before vortexing to shear the DNA. The sheared DNA (3–5 µg per reaction) was incubated at 95 °C for 5 min in the presence of the primer (FP-1) and Thermofidelase I (1 µl per reaction; Fidelity Systems), to unwind the template DNA. The Big Dye terminator mix (8 µl per reaction; ABI Prism) was then added along with distilled H2O to a final volume of 40 µl. Following 99 cycles of strand separation (95 °C, 30 s) and annealing/primer extension (60 °C, 4 min) the products were purified using the DyeEx 2.0 spin protocol (Qiagen) and separated on an ABI Prism 377 DNA sequencer. Disrupted genes were identified by BLAST searches of the Colibri (http://genolist.pasteur.fr/Colibri/index.html) or NCBI (http://www.ncbi.nlm.nih.gov/) websites.

The TnphoA mutagenesis was done with transformants of E. coli DH5{alpha} containing a plasmid (pGEM-ThlyE) that expresses a functional S. enterica Serovar Typhi haemolysin E. After cross-streak mating between DH5{alpha}(pGEM-ThlyE) and the TnphoA donor strain SM10(pRT733), transconjugants were selected on 2xLB50 (tryptone, 20 g l–1; yeast extract, 10 g l–1; NaCl, 5 g l–1) supplemented with tetracycline (10 µg ml–1), carbenicillin (50 µg ml–1) and kanamycin (10 µg ml–1). Pooled bacteria were grown and plasmids recovered for transformation into E. coli CC118 (phoA{Delta}20) for selection of Pho+ transformants in the presence of the antibiotics listed above and the alkaline phosphatase substrate 5-bromo-4-chloro-3-indolyl phosphate. Because the C-terminal region of the target protein is replaced by PhoA this method is unable to detect those proteins whose secretion is directed by C-terminally encoded signals.


    RESULTS
 TOP
 ABSTRACT
 INTRODUCTION
 METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
The hlyE gene of E. coli JM4660 does not encode Arg at position 188
The starting point for this work was the report that a strain of E. coli (JM4660) isolated from a chicken with colibacillosis and airsacculitis lacked the uropathogenic and enterohaemorrhagic haemolysin gene, hlyD, but did possess a homologue of the E. coli K-12 haemolysin E gene (Reingold et al., 1999Down). The JM4660 hlyE gene encoded a number of amino acid substitutions when compared to the E. coli K-12 sequence (Reingold et al., 1999Down). One of these substitutions, the replacement of Gly188 by Arg (numbering as for E. coli K-12) was problematical in the context of the E. coli K-12 HlyE 3-D structure (Wallace et al., 2000Down). This residue is located just before the {beta}-turn in the {beta}-tongue region, which forms the major hydrophobic patch of the HlyE surface and is responsible for interaction of HlyE with target membranes (Fig. 1Up) (Oscarsson et al., 1999Down; Wallace et al., 2000Down). Two possible ways of accommodating the reported Arg side chain were suggested, but both required substantial rearrangements in this crucial part of the HlyE protein (Wallace et al., 2000Down). This suggested that if indeed the substitution was authentic then the JM4660 HlyE could have some novel properties compared to the K-12 protein, and in view of its probable role as the only haemolysin in this avian strain it was of interest to investigate the role of Arg188 and the other amino acid substitutions. Therefore the hlyE gene from JM4660 was isolated and ligated with ptac85 to create the hlyE expression plasmid, pGS1590. To establish the authenticity of pGS1590 the inserted JM4660 hlyE gene was sequenced. When the latter was translated, the amino acid sequence corresponded exactly to that reported previously (Reingold et al., 1999Down), except that a Gly (GGG codon) and not Arg (AGG codon) residue was encoded at position 188 (Fig. 2Down). Furthermore, subsequent replacement of the Ala187, Gly188 motif of E. coli K-12 HlyE by the Gly187, Arg188 sequence of JM4660 HlyE resulted in an inactive protein, suggesting that the original report of Arg at position 188 (Reingold et al., 1999Down) was most likely the result of a sequencing error. Nevertheless, it was confirmed that the JM4660 HlyE possesses a further 76 amino acid substitutions compared to the K-12 HlyE (Reingold et al., 1999Down), and transformants of E. coli MC1000 expressing the JM4660 hlyE gene were haemolytic, indicating that, despite the numerous amino acid substitutions, the JM4660 HlyE protein is functional.



View larger version (24K):
[in this window]
[in a new window]
 
Fig. 2. Sequence alignments of members of the HlyE toxin family. The amino acid sequences of the HlyE toxin family studied in this work are shown: K-12, E. coli K-12; JM4660, avian E. coli isolate, as determined by Reingold et al. (1999)Down; JM4660{bullet}, the revised JM4660 sequence reported here. The E. coli K-12 sequence is used as the reference sequence, and only where the other bacterial sequences differ from this is the amino acid shown. Every tenth residue is marked, and the {alpha} helices (*) and {beta} strands (–1–; –2–) are indicated above the sequence. The Arg residue at position 188 in the original JM4660 sequence is highlighted in bold and underlined.

 
To investigate the possibility that the differences in primary structure between the JM4660 and the E. coli K-12 HlyE proteins might reflect the different environmental niches occupied by these strains, the JM4660 HlyE protein was isolated after overproduction from pGS1591 as a GST–HlyE fusion protein as described previously for the E. coli K-12 HlyE protein (Atkins et al., 2000Down). As a consequence of the strategy used to isolate the JM4660 protein, it, like the E. coli K-12 HlyE, was expected to possess an additional 15 N-terminal amino acids encoded by the thrombin-sensitive linker of pGEX-KG. Confirmation of the presence of these additional amino acids (shown in italics, see below) and that the JM4660 HlyE had been overproduced was provided by N-terminal amino acid sequencing (GSPGISGGGGGILDSMTNADQTVETVKTAID). Despite the differences in primary structure between the K-12 and JM4660 HlyE proteins they proved to have very similar properties. The JM4660 protein formed pores in lipid vesicles, which when viewed perpendicular to the plane of the membrane appeared as clustered ring-shaped assemblies with an internal diameter of 36–41 Å, and external diameters of 86–92 Å (Fig. 3Down). These structures resembled the majority of the pores formed by the E. coli K-12 HlyE protein (42–52 Å internal diameter and 70–90 Å external diameter; Wallace et al., 2000Down). The JM4660 HlyE pores were homogeneous, and examples of the larger assemblies (55–60 Å internal diameter and 90–105 Å external diameter; Wallace et al., 2000Down) that form a minority population amongst the K-12 HlyE pores were not observed with JM4660 protein (Table 2Down). Thus, the dimensions of the JM4660 assemblies are consistent with the formation of an octomeric pore (Wallace et al., 2000Down; Atkins et al., 2000Down). Some images contained a central, stain-excluding density suggesting that, in these cases, the diameter of the pore might be restricted (Fig. 3Down). In addition, side-views of the pore assemblies could be seen as spikes (90–100 Å) extending from the edges of the vesicles, indicating that, as observed with the E. coli K-12 protein (Wallace et al., 2000Down), major conformational changes are not required for HlyE to interact with target membranes. Moreover, the JM4660 HlyE was resistant to protease treatment, was inhibited by incubation with Hg(II), and did not require post-translational modification for activity (Table 2Down). Estimation of the native molecular mass of JM4660 HlyE indicated that in contrast to the K-12 HlyE, the majority of the protein was dimeric (Table 2Down). Like E. coli K-12 HlyE, the protein from JM4660 was active against red blood cells from a wide range of species. However, it may be significant, in view of its avian niche, that it was twice as effective as the K-12 protein against chicken erythrocytes (Table 3Down), and that it had enhanced thermostability compared to the K-12 protein, in accord with the higher core temperature of birds compared to mammals (Table 2Down). These adaptations may be mediated by the many amino acid sequence differences compared to the K-12 protein, which presumably contribute to the predominance of the dimeric form of the JM4660 protein.



View larger version (196K):
[in this window]
[in a new window]
 
Fig. 3. Electron micrograph of JM4660 HlyE in lipid vesicles. The micrograph shows negatively stained lipid vesicles. The HlyE pores appear as stain-filled rings (R) when viewed parallel to the membrane and as protruding spikes at the folded edges of the vesicles when viewed from the side (S). Some pore assemblies contain a stain-excluding central density (E).

 

View this table:
[in this window]
[in a new window]
 
Table 2. Properties of HlyE proteins isolated from GST–HlyE fusions

 

View this table:
[in this window]
[in a new window]
 
Table 3. Activity of isolated HlyE proteins from E. coli K-12 and JM4660 with different target erythrocytes

Haemolytic activity was determined as described in Methods with equivalent amounts (20 ng) of HlyE protein from the indicated source. The values given are the means of duplicate assays from two experiments that varied by <10 %. 100 % is equivalent to a specific activity of 4x105 units mg–1.

 
During the isolation of the JM4660 HlyE it was noted that much of the GST–HlyE protein bound to GSH-Sepharose was associated with lipid, appearing as a brown band at the top of the chromatography columns. This complex was released from the chromatography medium upon treatment with thrombin, suggesting that the GST component of the fusion was free to interact with the GSH-Sepharose and thrombin, and that the HlyE component was associated with the E. coli lipids. However, this was not observed with the E. coli K-12 GST-HlyE fusion. The protein profile of the thrombin-released JM4660 HlyE–lipid complexes was analysed by N-terminal amino acid sequencing. Three major polypeptides were visible on Coomassie-blue-stained denaturing gels. The major band (49 % of total protein in the sample) was HlyE (GSPGISGG). The second most abundant polypeptide (17 % of the total) had an apparent molecular mass and amino acid sequence (AEVYNKD) identical to OmpC, OmpN and YedS. The third most abundant polypeptide (11 % of the total) identified was SdhB (MRLEFSIY), the iron–sulphur protein component of the inner-membrane-bound succinate dehydrogenase complex. This suggests that the JM4660 HlyE is associated with E. coli membranes under these conditions, but conversely, such an association was not apparent for the K-12 HlyE. Evidence that HlyE can interact with E. coli lipids, forming assemblies resembling those observed for eukaryotic lipid vesicles, was obtained by electron microscopy (not shown). Although the interaction with the E. coli lipids occurred much more slowly than equivalent reactions with eukaryotic lipids, the physical appearance of the pores was indistinguishable. These observations suggest that the amino acid changes in JM4660 HlyE affect the cellular location of this protein in E. coli, which ultimately may have consequences for its action on target cells.

Status of the hlyE genes of non-haemolytic variants of E. coli JM4660
During the isolation of the JM4660 hlyE gene it was noticed that after overnight growth on blood agar a significant number of colonies with an impaired haemolytic phenotype were present. Picking and restreaking haemolytic colonies always yielded some apparently non-haemolytic colonies amongst the majority of strongly haemolytic colonies (Fig. 4Down). In aerobic liquid culture in rich medium (Lennox broth) the non-haemolytic variants grew as well as their haemolytic parents, and so the non-haemolytic phenotype was apparently not caused by a general growth defect (not shown). These observations were interesting because previous reports have indicated that the hlyE genes of many clinical strains of E. coli contain deletions that preclude the formation of functional HlyE protein (Atkins et al., 2000Down; Ludwig et al., 1999Down). Therefore, high-fidelity PCR (using primers AA49 and AA50, see Table 1Up) was used to amplify and isolate the hlyE genes from one haemolytic (H) and four non-haemolytic colonies of JM4660 (designated J1–J4). The PCR products were then sequenced by automated cycle DNA sequencing with primers AA53–64 (Table 1Up). Surprisingly, all the non-haemolytic isolates (J1–J4) tested still possessed full-length hlyE genes, predicted to encode proteins with amino acid sequences identical to that of the haemolytic strain. Thus, it would appear that the non-haemolytic variants of JM4660 had arisen by mechanisms other than by mutations within the hlyE gene.



View larger version (39K):
[in this window]
[in a new window]
 
Fig. 4. The haemolytic phenotype of E. coli JM4660 is unstable. The four non-haemolytic colonies of JM4660 (J1–J4) illustrated were picked from a blood agar plate and grown for 16 h at 37 °C on fresh blood agar along with a haemolytic colony (H) as a control.

 
Non-haemolytic variants of E. coli JM4660 fail to export HlyE
Because the four apparently non-haemolytic JM4660 variants (J1–J4) all possessed the same complete and unaltered hlyE coding regions, their ability to produce active HlyE protein was tested. This was done to establish whether these bacteria had become non-haemolytic through mutations affecting transcription or translation. Cell-free extracts from aerobic overnight cultures of the five JM4660 isolates (one haemolytic, H, and the four non-haemolytic isolates, J1–J4) were tested for haemolytic activity. As expected the cell-free extracts prepared from the haemolytic strain were active against horse erythrocytes, but surprisingly the cell-free extracts from the non-haemolytic variants (J1–J4) also possessed haemolytic activity (Table 4Down). Therefore, it was concluded that the non-haemolytic phenotype was not due to an inability to produce the HlyE protein per se.


View this table:
[in this window]
[in a new window]
 
Table 4. Representative subcellular fractionation of haemolytic (H) and non-haemolytic (J1–J4) E. coli JM4660

Cultures of the indicated strains were grown under aerobic conditions for 16 h at 37 °C in Lennox broth. The bacteria were collected, the cytoplasmic (C), periplasmic (P) and external medium (M) fractions were isolated, and haemolysin E (HlyE) activities were determined. HlyE activities are expressed as units min–1 mg–1 for the cytoplasmic and periplasmic fractions and as units min–1 ml–1 for the external medium (Rowe & Welch, 1994Down). Values quoted are the means and standard deviations of duplicate measurements from two cultures.

 
The export of HlyE from E. coli is poorly understood. The protein itself does not possess any of the previously recognized signal sequences that target a protein for export. However, it is known that when HlyE is overproduced in E. coli K-12 the protein accumulates in the periplasm, and thus there must be a mechanism for trafficking HlyE to the periplasmic space. It has been suggested that blebbing of outer membrane vesicles provides at least one mechanism by which HlyE is released from the periplasm into the external medium (Wai et al., 2000Down, 2003aDown). Therefore, subcellular fractionation was used to isolate cytoplasmic, periplasmic and extracellular fractions from overnight aerobic cultures of the five JM4660 isolates (one haemolytic, H, and four non-haemolytic colonies, J1–J4, shown in Fig. 4Up). Activity measurements revealed that the HlyE protein was present in all three fractions (extracellular, cytoplasmic and periplasmic) obtained from the haemolytic strain. However, although HlyE activity was present in the cytoplasmic fractions it was not detected in the periplasm or extracellular medium of the non-haemolytic variants (Table 4Up). In two cases (J2 and J3) the HlyE activities of the cell-free extracts were significantly lower than those of the other strains (H, J1 and J4), suggesting that less HlyE protein is produced by these strains (Table 4Up). The HlyE activities in cell-free extracts of the remaining non-haemolytic variants (J1 and J4) were comparable to that obtained with the haemolytic strain (H), suggesting that in these cases HlyE export is somehow impaired (Table 4Up). To ensure that the isolated periplasmic fractions were free of cytoplasmic contamination the distribution of the cytoplasmic proteins aconitase and lipoamide dehydrogenase was determined by measuring enzyme activities. Significant quantities of both enzymes were only detected in the cytoplasmic fractions (60–170 units of aconitase activity min–1 mg–1 and 0·8–16·8 units of lipoamide dehydrogenase activity h–1 mg–1), but not in the periplasmic fractions (<2 units of aconitase min–1 mg–1 and <0·01–0·10 units of lipoamide dehydrogenase activity h–1 mg–1). Therefore, it was concluded that the periplasmic fractions were essentially free of cytoplasm, and that the non-haemolytic phenotype of strains J1 and J4 arises from an inability to export HlyE from the cytoplasm to the periplasm.

The amino-terminal region of HlyE is required for export
A previous study identified two HlyE variants with single amino acid substitutions (N157H and Y165C) whose properties suggested that export of these proteins was impaired (Atkins et al., 2000Down). To investigate further which regions of HlyE are required for export from E. coli the S. enterica serovar Typhi hlyE was randomly mutagenized using the transposon TnphoA. Transposition of TnphoA allows random formation of in-frame fusions of the N-terminus of PhoA to a target protein, in this case HlyE. Target proteins that are secreted to the periplasm, or which are surface-exposed, or exported from the bacteria, are easily identified on PhoA indicator plates. Using TnphoA mutagenesis 4 out of 621 PhoA+ colonies lacked haemolytic activity. After DNA sequencing of one non-haemolytic isolate an in-frame insertion of PhoA after residue 179 of HlyE was detected. This insertion is at the end of {alpha}D; it interrupts HlyE just before the hydrophobic {beta}-tongue and removes the final 125 amino acids of HlyE. Interestingly, the previously described amino acids that apparently impair HlyE export are also located in {alpha}D (Atkins et al., 2000Down). Therefore, it is concluded that the carboxyl-terminus of HlyE is not required for HlyE export into the periplasmic space of E. coli and that {alpha}D plays an important role in this process.

Transposon mutagenesis to identify genes potentially involved in HlyE export
Transposon mutagenesis was used to discover more about the mechanism by which HlyE is exported to the external milieu. It was not possible to use JM4660 as the host for mutagenesis because of its propensity to spawn non-haemolytic variants. Thus the non-haemolytic E. coli strain EC100 was co-transformed with a plasmid (pGS415; Table 1Up), expressing the Actinobacillus pleuropneumoniae FNR (HlyX) in order to confer a strong haemolytic phenotype, and the transposome complex EZ : : Tn<KAN-2>Tnp. The transposon library was screened for colonies displaying impaired haemolysis on blood agar. Seven candidates emerged, from which genomic DNAs were prepared and the disrupted genes identified by DNA sequencing. Amongst these were two different examples of hlyE coding sequence lesions (Table 5Down). Five other insertion mutants that produced active HlyE protein, but had an impaired haemolytic phenotype, were unambiguously identified (Table 5Down). These included lesions in two genes of unknown function (yjhI and yqeB) and three genes with links to the cell envelope (sfmA, waaG and tatC). Because the tatC gene encodes an essential component of the twin-arginine protein translocase, so called because conventional substrates contain an N-terminal (S/T)RRXFLK motif that is required for recognition (Berks et al., 2000Down), and is involved in trafficking proteins to the periplasm, the effects of the tatC lesion on HlyE export were further characterized. Estimation of the HlyE content of the tatC strain indicated that it possessed relatively more HlyE than the parent, suggesting an HlyE export defect (Table 5Down). To confirm that the impaired haemolytic phenotype was linked to transposon insertion into tatC, an independent tatC mutant was created and, as expected, after transformation with pGS415 the resulting strain had an impaired haemolytic phenotype (not shown).


View this table:
[in this window]
[in a new window]
 
Table 5. Transposon mutants with impaired haemolytic phenotypes

The locations of transposon insertions that cause reduced zones of haemolysis on blood agar surrounding colonies of E. coli EC100(pGS415) are indicated, with the known or predicted functions of the corresponding genes. The relative haemolytic activities of cell-free extracts prepared from the indicated mutants were estimated relative to the activity of the EC100(pGS415) parental strain (=100). Representative values from three separate experiments are provided. The relative amounts of HlyE present in the cultures were estimated by Western blotting using polyclonal anti-HlyE serum and quantitative densitometry of the corresponding blots (not shown). The values are the mean levels of HlyE detected in two separate experiments in which the amount of HlyE in cultures of EC100(pGS415) was fixed at 100.

 
Inspection of the HlyE amino acid sequence did not reveal a potential Tat motif. However, not all Tat substrates possess a canonical motif and it was possible that HlyE might exit the cytoplasm via interaction with a bona fide Tat substrate. Therefore, the ability of the tatC mutant to export HlyE was investigated further. The approach taken was based on a recent study in which Tat-mediated export was investigated using GFP–SsrA fusions (DeLisa et al., 2002Down). Here an HlyE–SsrA fusion was used. The SsrA tag (AANDENYALAA) fused to the C-terminus of HlyE directs the cytoplasmic ClpXP and ClpAP proteases to rapidly and efficiently degrade HlyE-SsrA. Thus, if a tatC mutant is impaired in the ability to export HlyE across the inner membrane, HlyE–SsrA will be trapped in the cytoplasm, where it will be degraded, whereas the parental strain will translocate HlyE–SsrA to the periplasm, where it will be protected from Clp-mediated degradation. To prevent saturation of the proteases HlyE–SsrA was expressed without induction from a pBAD-based plasmid, pGS1699 (Table 1Up). As observed for native HlyE, colonies of the tat mutant expressing the HlyE-SsrA fusion were less haemolytic than the corresponding parental strain on blood agar. However, Western blotting of whole cells from liquid cultures of the parent and the tat strain revealed that they possessed similar amounts of HlyE protein (not shown). The simplest explanation for these observations is that transfer of the HlyE–SsrA fusion from the cytoplasm to the periplasm is not impaired in the tat strain, but that export of HlyE–SsrA from the periplasm across the outer membrane must be more efficient in the parent to account for its enhanced haemolytic phenotype compared to the tatC mutant. A role for the outer membrane in HlyE export would be consistent with the reduced haemolysis associated with the disruption of genes linked to outer membrane structure–function (sfmA, tatC, and waaG) and the co-purification of HlyE with proteins of the inner and outer membrane (Table 5Up).


    DISCUSSION
 TOP
 ABSTRACT
 INTRODUCTION
 METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
The work described here was prompted by a report that the hlyE gene of an avian E. coli isolate, JM4660, encoded an Arg residue at a position occupied by Gly188 in the E. coli K-12 protein (Reingold et al., 1999Down), and the observation that growth of JM4660 on blood agar spawned non-haemolytic colonies. The experiments described lead to four conclusions. Firstly, that an Arg residue at position 188 abolishes HlyE activity. Secondly, that translocation of HlyE is not an intrinsic property of the protein but requires additional components. Thirdly, that translocation to the periplasm does not require the C-terminal region of HlyE. And fourthly, lesions in a subset of genes that affect outer membrane integrity impair HlyE export.

The reported substitution of Gly188 by Arg in the JM4660 HlyE protein was difficult to reconcile with the 3-D structure of HlyE and we have now shown that replacement of Gly188 by Arg inactivates E. coli K-12 HlyE, and that in fact contrary to a previous report (Reingold et al., 1999Down), Gly occupies this position in HlyE from JM4660. Nevertheless, the JM4660 hlyE gene encoded 76 amino acid substitutions relative to the HlyE of E. coli K-12, with the only extended region of conservation being the hydrophobic {beta}-tongue that is required for interaction with target membranes (Wallace et al., 2000Down). This, combined with the observation that the HlyE(Ala187->Gly, Gly188->Arg) variant is inactive, emphasizes the importance of this region for HlyE function. Indeed the overall properties of the K-12 and JM4660 proteins were remarkably similar, despite the differences in primary structure, which is particularly marked at the C-terminal end of the protein, where 17 of the last 35 residues are substituted. This latter observation is of interest because the JM4660 HlyE protein appeared to be more thermostable than the K-12 equivalent, and it has been shown that at least one substitution in the C-terminal region (Cys285->Ser) dramatically reduces the thermostability of HlyE (Wallace et al., 2000Down). Moreover, the HlyE protein from JM4660 was predominantly dimeric in solution and thus was much more homogeneous than the E. coli K-12 equivalent, which has been observed in a variety of oligomeric states (monomer, dimer, and 8–12-mer) (Wallace et al., 2000Down; Atkins et al., 2000Down). In the crystal structure of water-soluble HlyE a dimer was formed by the head-to-tail arrangement of HlyE subunits such that the hydrophobic {beta}-tongue and a second hydrophobic region consisting of residues Val89, Ala95, Ala96, Ile98, Leu99, Leu100, Ile115 and Ile282 located mainly within the C-terminus of {alpha}B pack against each other to sequester these surfaces from the solvent (Wallace et al., 2000Down). Comparing the JM4660 and K-12 proteins it is now clear that the residues of the {beta}-tongue are highly conserved and its hydrophobic makeup is preserved. However, Ala95 and Leu99 of the second hydrophobic patch are replaced by Thr and Ser, respectively, in JM4660 HlyE. Inspection of the crystallographic dimer reveals that neither of these substitutions would generate any new interactions that could stabilize the HlyE dimer. There are relatively few specific interactions between the two molecules of the E. coli K-12 HlyE crystallographic dimer, with only six direct protein–protein hydrogen bonds per subunit (Wallace et al., 2000Down). However, examination of the differences in the amino acid sequence of the HlyE proteins did reveal three additional possible interactions in the avian E. coli protein that could help stabilize the HlyE dimer (Fig. 5Down). Replacement of Asp114 by Thr may allow the formation of a hydrogen bond with the main chain N of Ala183; the double substitution Gln52->Glu and Glu129->Lys may promote the formation of a salt bridge; and replacement of Asp41 by Asn should remove a charge repulsion across the two-fold axis and lead to hydrogen bonding. Thus, it is suggested that these amino acid substitutions lead to additional interactions between subunits of the JM4660 HlyE and contribute to the formation of a more stable HlyE dimer. The observation that the JM4660 HlyE protein is predominantly dimeric in solution supports the suggestion that dimerization is used to maintain high solubility in aqueous media by hiding the hydrophobic lipid-binding amino acid residues from the solvent (Wallace et al., 2000Down). Such a strategy is used by the water-soluble pore-forming toxin proaerolysin (Parker et al., 1996Down). Comparison of the amino acid sequences of the E. coli K-12 and JM4660 HlyE proteins reveals that most of the non-conservative amino acid substitutions are confined to the tail domain. This would be consistent with the head and central regions forming the core interactions between HlyE and target membranes, and between HlyE subunits in the assembled pore. Variation in the tail domain (predicted to extend from the membrane into the surrounding milieu) may contribute to antigenic variation in the HlyE proteins, which may be important if at least some HlyE is exported as a component of an outer-membrane vesicle (see below; Wai et al., 2000Down, 2003aDown).



View larger version (63K):
[in this window]
[in a new window]
 
Fig. 5. The HlyE dimeric interface. Stereodiagrams showing two E. coli K-12 HlyE monomers, forming a dimer across the crystallographic two-fold axis, shown in (a) as main chain ribbons and in (b) in a space-filling representation. One monomer is shown in white, and the other in cyan; residues non-identical between E. coli K-12 HlyE and avian E. coli HlyE are highlighted on these monomers in green and dark blue, respectively. Sequence changes thought likely to alter the dimeric interaction are indicated in magenta. Both figures were created using MIDAS (Ferrin et al., 1988Down).

 
The observation that JM4660 spawned non-haemolytic variants that expressed active HlyE proteins, but failed to export that protein to the periplasm and ultimately to the external medium, indicated that export is not an intrinsic property of the HlyE protein but requires additional components, which have been subverted in the non-haemolytic variants. The existence of an HlyE export system was suggested previously following the observation that the secretion of HlyE to the extracellular medium is independent of cytolytic activity (del Castillo et al., 2001Down). It has also been shown that, despite the lack of any previously recognized signal sequence, HlyE is transferred to the periplasm of E. coli, where it accumulates (Atkins et al., 2000Down; Ludwig et al., 1999Down; Wai et al., 2003bDown) and that this is independent of the type I, II, III, IV and V secretory systems (Wai et al., 2000Down). Thus, the process leading to the transfer of HlyE across the inner membrane is different from that used by other pore-forming toxins; e.g. proaerolysin translocation to the periplasm occurs co-translationally and requires the sec machinery (Parker et al., 1996Down). The finding that disruption of tatC, a component of the Tat pathway that mediates the translocation of folded proteins across the cytoplasmic membrane, impaired HlyE export suggested that Tat might direct HlyE to the periplasm. However, the absence of a Tat signal sequence within HlyE and the observation that HlyE apparently reaches the periplasm of a tatC mutant suggests an indirect role for Tat (see below). The failure of HlyE to reach the periplasm of the non-haemolytic JM4660 isolates characterized here implies that a distinct as yet unknown mechanism to transfer HlyE to the periplasm exists. The TnphoA mutagenesis studies indicated that this export mechanism does not require the C-terminal region of HlyE, suggesting that the export sequence is located within the first 179 amino acids of HlyE. This is consistent with two HlyE variants with single amino acid substitutions (N157H and Y165C) that impair export (Atkins et al., 2000Down). Thus, it would appear that an intact {alpha}D helix is important for HlyE translocation to the periplasm, consistent with the high level of amino acid conservation in this region of the protein (Fig. 2Up).

To attack a target cell HlyE has to be released from the periplasm into the extracellular milieu. It has been suggested that export of HlyE from the periplasm is mediated, at least in part, by outer-membrane blebbing (Wai et al., 2000Down, 2003aDown) and it is known that tat strains have defective outer membranes (Ize et al., 2003Down; Stanley et al., 2001Down). A membrane blebbing mechanism for HlyE export would be consistent with our observation that HlyE can be isolated in association with membrane proteins, and that mutations affecting the cell envelope (tatC, sfmA and waaG) can impair HlyE export. Thus, it would appear that the transposon insertions that impair HlyE export are linked to outer membrane structure–function. Hence, the integrity, composition and/or stability of the outer membrane are clearly important factors for the export of active HlyE.

In conclusion, the results reported here demonstrate the presence of a functional HlyE toxin in an avian E. coli isolate that lacks other haemolysins. Characterization of the isolated protein emphasized the importance of the {beta}-tongue in HlyE function and provided evidence for dimerization as a strategy for improving toxin solubility. Moreover, the characterization of non-haemolytic variants of E. coli JM4660 and transposon mutagenesis indicates that export of active HlyE to the periplasm does not require the C-terminal region of HlyE and is not an intrinsic property of the protein itself but requires additional components, including the integrity of the outer membrane.


    ACKNOWLEDGEMENTS
 
We thank John Maurer (University of Georgia) for E. coli strain JM4660, Dr Tracy Palmer for useful discussions and sharing unpublished information, and colleagues Simon Thorpe for mass spectrometry and Arthur Moir for DNA and protein sequencing. This work was supported by the Biotechnology and Biological Sciences Research Council UK.


    REFERENCES
 TOP
 ABSTRACT
 INTRODUCTION
 METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
Atkins, A., Wyborn, N. R., Wallace, A. J., Stillman, T. J., Black, L. K., Fielding, A. B., Hisakado, M., Artymiuk, P. J. & Green, J. (2000). Structure-function relationships of a novel bacterial toxin, haemolysin E. J Biol Chem 275, 41150–41155.[Abstract/Free Full Text]

Berks, B. C., Sargent, F. & Palmer, T. (2000). The Tat protein export pathway. Mol Microbiol 35, 260–274.[CrossRef][Medline]

Creaghan, I. T. & Guest, J. R. (1972). Amber mutants of the {alpha}-ketoglutarate dehydrogenase gene of Escherichia coli. J Gen Microbiol 71, 207–220.[Medline]

del Castillo, F. J., Leal, L. C., Moreno, F. & del Castillo, I. (1997). The Escherichia coli K-12 sheA gene encodes a 34-kDa secreted haemolysin. Mol Microbiol 25, 107–115.[CrossRef][Medline]

del Castillo, F. J., Moreno, F. & del Castillo, I. (2001). Secretion of the Escherichia coli K-12 SheA hemolysin is independent of its cytolytic activity. FEMS Lett 204, 281–285.

DeLisa, M. P., Samuelson, P., Palmer, T. & Georgiou, G. (2002). Genetic analysis of the twin arginine translocator secretion pathway in bacteria. J Biol Chem 277, 29825–29831.[Abstract/Free Full Text]

Ferrin, T. E., Huang, C. C., Jarvis, L. E. & Langridge, R. (1988). The MIDAS display system. J Mol Graph 6, 13–27.

Green, J. & Baldwin, M. L. (1997). The molecular basis for the differential regulation of the hlyE-encoded haemolysin of Escherichia coli by FNR and HlyX lies in the improved activating region 1 contact of HlyX. Microbiology 143, 3785–3793.[Abstract]

Gross, W. B. (1991). Diseases of Poultry, 9th edn, pp. 138–144. Edited by B. Clanek, H. J. Barnes, C. W. Beard, W. M. Reid & H.W. Yorder, Jr. Ames, IA: Iowa State University Press.

Gruer, M. J., Bradbury, A. J. & Guest, J. R. (1997). Construction and properties of aconitase mutants of Escherichia coli. Microbiology 143, 1837–1846.[Abstract]

Guan, K. & Dixon, J. E. (1991). Eukaryotic proteins expressed in Escherichia coli: an improved thrombin cleavage and purification procedure of fusion proteins with glutathione-S-transferase. Anal Biochem 192, 262–267.[CrossRef][Medline]

Ize, B., Stanley, N. R., Buchanan, G. & Palmer, T. (2003). The role of Escherichia coli Tat pathway in outer membrane integrity. Mol Microbiol 48, 1183–1193.[CrossRef][Medline]

Lai, X. H., Johansson, A. I., Wai, S. N., Oscarsson, J., Kalfas, S., Sundqvist, K. G., Mizunoe, Y., Sjostedt, A. & Uhlin, B. E. (2000). Cytocidal and apoptopic effects of the ClyA protein from Escherichia coli on primary and cultured monocytes and macrophages. Infect Immun 68, 4363–4367.[Abstract/Free Full Text]

Ludwig, A., Bauer, S., Benz, R., Bergmann, B. & Goebel, W. (1999). Analysis of the SlyA-controlled expression, subcellular localization and pore-forming activity of a 34 kDa haemolysin (ClyA) from Escherichia coli. Mol Microbiol 31, 557–567.[CrossRef][Medline]

Manoil, C. & Beckwith, J. (1985). TnPhoA: a transposon probe for protein export signals. Proc Natl Acad Sci U S A 82, 8129–8133.[Abstract/Free Full Text]

Marsh, P. (1986). ptac85, an Escherichia coli vector for expression of non-fusion proteins. Nucleic Acids Res 14, 3603.[Free Full Text]

Oscarsson, J., Mizunoe, Y., Uhlin, B. E. & Haydon, D. J. (1996). Induction of haemolytic activity in Escherichia coli by the slyA gene product. Mol Microbiol 20, 191–199.[Medline]

Oscarsson, J., Mizunoe, Y., Li, L., Lai, X.-H., Weislander, A. & Uhlin, B. E. (1999). Molecular analysis of the cytolytic protein ClyA (SheA) from Escherichia coli. Mol Microbiol 32, 1226–1238.[CrossRef][Medline]

Oscarsson, J., Westermark, M., Lofdahl, S., Olsen, B., Palmgren, H., Mizunoe, Y., Wai, S. N. & Uhlin, B. E. (2002). Characterization of a pore-forming cytotoxin expressed by Salmonella enterica serovars Typhi and Paratyphi A. Infect Immun 70, 5759–5769.[Abstract/Free Full Text]

Parker, M. W., van der Groot, F. G. & Buckley, J. T. (1996). Aerolysin – the ins and outs of a model channel-forming protein. Mol Microbiol 19, 205–212.[CrossRef][Medline]

Reingold, J., Starr, N., Maurer, J. & Lee, M. D. (1999). Identification of a new Escherichia coli She haemolysin homolog in avian E. coli. Vet Microbiol 66, 125–134.[CrossRef][Medline]

Rowe, G. E. & Welch, R. A. (1994). Assays of haemolytic toxins. Methods Enzymol 235, 657–669.[Medline]

Sambrook, J. W. & Russell, D. W. (2001). Molecular Cloning: a Laboratory Manual, 3rd edn. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory.

Silhavy, T. J., Barman, M. L. & Enquist, L. W. (1984). Experiments with Gene Fusions. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory.

Stanley, N. R., Findlay, K., Berks, B. C. & Palmer, T. (2001). Escherichia coli strains blocked in Tat-dependent protein export exhibit pleiotropic defects in the cell envelope. J Bacteriol 183, 139–144.[Abstract/Free Full Text]

Taylor, R. K. C., Manoil, C. & Mekalanos, J. J. (1989). Broad host range vectors for the delivery of TnPhoA: use in genetic analysis of secreted virulence determinants of Vibrio cholerae. J Bacteriol 171, 1870–1878.[Abstract/Free Full Text]

Wai, S. N., Westermark, M., Oscarsson, J., Mizunoe, Y. & Uhlin, B. E. (2000). Localisation and export of the ClyA cytotoxin in Escherichia coli. Med Microbiol Immunol 189, 51.

Wai, S. N., Lindmark, B., Soderblom, T. & 7 other authors (2003a). Vesicle-mediated export and assembly of pore-forming oligomers of the enterobacterial ClyA protein. Cell 115, 25–35.[CrossRef][Medline]

Wai, S. N., Westermark, M., Oscarsson, J., Jass, J., Maier, E., Benz, R. & Uhlin, B. E. (2003b). Characterization of dominantly negative mutant ClyA cytotoxin proteins in Escherichia coli. J Bacteriol 185, 5491–5499.[Abstract/Free Full Text]

Wallace, A. J., Stillman, T. J., Atkins, A., Jamieson, S. J., Bullough, P. A., Green, J. & Artymiuk, P. J. (2000). E. coli Haemolysin E (HlyE, ClyA, SheA): X-ray crystal structure of the toxin and observation of membrane pores by electron microscopy. Cell 100, 265–276.[CrossRef][Medline]

Westermark, M., Oscarsson, J., Mizunoe, Y., Urbonaviciene, J. & Uhlin, B. E. (2000). Silencing and activation of ClyA cytotoxin expression in Escherichia coli. J Bacteriol 182, 6347–6357.[Abstract/Free Full Text]

Received 31 October 2003; revised 8 January 2004; accepted 28 January 2004.


This article has been cited by other articles:


Home page
MicrobiologyHome page
S. Hunt, A. J. G. Moir, S. Tzokov, P. A. Bullough, P. J. Artymiuk, and J. Green
The formation and structure of Escherichia coli K-12 haemolysin E pores
Microbiology, February 1, 2008; 154(2): 633 - 642.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
C. Constantinidou, J. L. Hobman, L. Griffiths, M. D. Patel, C. W. Penn, J. A. Cole, and T. W. Overton
A Reassessment of the FNR Regulon and Transcriptomic Analysis of the Effects of Nitrate, Nitrite, NarXL, and NarQP as Escherichia coli K12 Adapts from Aerobic to Anaerobic Growth
J. Biol. Chem., February 24, 2006; 281(8): 4802 - 4815.
[Abstract] [Full Text] [PDF]


Home page
Infect. Immun.Home page
J. E. Galen, L. Zhao, M. Chinchilla, J. Y. Wang, M. F. Pasetti, J. Green, and M. M. Levine
Adaptation of the Endogenous Salmonella enterica Serovar Typhi clyA-Encoded Hemolysin for Antigen Export Enhances the Immunogenicity of Anthrax Protective Antigen Domain 4 Expressed by the Attenuated Live-Vector Vaccine Strain CVD 908-htrA
Infect. Immun., December 1, 2004; 72(12): 7096 - 7106.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow